Pigment Epithelium-derived Factor

Document technical information

Format pdf
Size 198.4 kB
First found May 22, 2018

Document content analysis

Category Also themed
Language
English
Type
not defined
Concepts
no text concepts found

Persons

Organizations

Places

Transcript

SPECIFICATION SHEET
Rev 082669A
Pigment Epithelium-derived Factor
Human, Recombinant (rHuPEDF)
Expressed in E. coli
Cat. No. CRP0870
Lot. No. (See product label)
PRODUCT INFORMATION
Description: PEDF is a noninhibitory serpin with
neurotrophic,
anti-angiogenic,
and
anti-tumorigenic
properties. It is a 50 kDa glycoprotein produced and secreted
in many tissues throughout the body. A major component of
the anti-angiogenic action of PEDF is the induction of
apoptosis in proliferating endothelial cells. In addition, PEDF
is able to inhibit the activity of angiogenic factors such as
VEGF and FGF-2. The neuroprotective effects of PEDF are
achieved through suppression of neuronal apoptosis induced
by peroxide, glutamate, or other neurotoxins. The recent
identification of a lipase-linked cell membrane receptor for
PEDF (PEDF-R) that binds to PEDF with high affinity should
facilitate further elucidation of the underlying mechanisms of
this pluripotent serpin. To date, PEDF-R is the only signaling
receptor known to be used by a serpin family member.
Amino-Acid Sequence: 400 aa (The first 52 amino acid is:
MQNPASPPEEGSPDPDSTGALVEEEDPFFKVPVNKLAAAV
SNFGYDLYRVRS), non-glycosylated
M. W. : 44,500 Da
Recombinant: Expressed in E. coli
Purity: >95% by SDS-PAGE and HPLC analyses.
Formulation: Lyophilized from a 0.2mm filtered
concentrated (1.0mg/ml) solution in 20mM PB, pH7.4,
150mM NaCl.
Endotoxin: Less than 1EU/mg of rHuPEDF as determined
by LAL method.
Reconstitution: We recommend that this vial be briefly
centrifuged prior to opening to bring the contents to the
bottom. Reconstitute in sterile distilled water or aqueous
buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/
ml. Stock solutions should be apportioned into working
aliquots and stored at <-20°C. Further dilutions should be
made in appropriate buffered solutions.
Storage: This lyophilized preparation is stable for several
weeks at 2-8°C, but should be kept at –20°C for long term
storage, preferably desiccated. Upon reconstitution, the
preparation is stable for up to one week at 2-8°C. For
maximal stability, apportion the reconstituted preparation into
working aliquots and store at –20° C to –70° C. Avoid
repeated freeze/thaw cycles.
PDB rendering based on 1imv.
GENE INFORMATION
Gene Name: SERPINF1
Synonyms: EPC-1; PEDF; PIG35; Serpin-F; pigment
epithelium-derived factor; proliferation-inducing protein 35;
serine (or cysteine) proteinase inhibitor, clade F (alpha-2
antiplasmin, pigment epithelium derived factor), member 1;
Pigment epithelium-derived factor precursor; serpin
peptidase inhibitor, clade F (alpha-2 antiplasmin, pigment
epithelium derived factor), member 1
Gene Type: protein coding
mRNA Refseq: NM_002615
Protein Refseq: NP_002606
MIM: 172860
GeneID:5176
Uniprot ID: P36955
Chromosome Location: 17p13.1
Function: serine-type endopeptidase inhibitor activity
Process: cell proliferation, multicellular organismal
development, negative regulation of angiogenesis.
REFERENCES
1. Tong JP, Yao YF. Contribution of VEGF and PEDF to
choroidal angiogenesis: a need for balanced expressions.
Clin. Biochem. 2006; 39 (3): 267–276.
2.Becerra SP, Sagasti A, Spinella P, Notario V. Pigment
epithelium-derived factor behaves like a noninhibitory serpin.
Neurotrophic activity does not require the serpin reactive
loop. J. Biol. Chem. 1995; 270 (43): 25992–25999.
FOR RESEARCH USE ONLY
@ 2005-2008 Creative Biolabs. All rights reserved.
21 Brookhaven BLVD ·Port Jefferson Station, NY 11776, USA
Technical Support: T: 631-871-5806 ·F: 631-207-8356
E-mail: [email protected]
www.creative-biolabs.com

Similar documents

×

Report this document